Loading...
Statistics
Advertisement

Crescent Capital Partners | grow. increase. expand.
www.crescentcap.com.au/

Crescentcap.com.au

Advertisement
Conversion Technology Metas Server
Crescentcap.com.au is hosted in Australia . Crescentcap.com.au uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Html5, Number of used javascripts: 2. First javascripts: Jquery.min.js, Main.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: LiteSpeed. Its CMS is: Wordpress.

Technologies in use by Crescentcap.com.au

Technology

Number of occurences: 6
  • CSS
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 2
  • jquery.min.js
  • main.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • LiteSpeed

Powered by

  • PHP/5.4.45

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Crescentcap.com.au

SSL certificate

    • name: /serialNumber=oMSq2qRxRdxoQ4gT2A9XVGnDKoWLRoem/OU=GT70962531/OU=See www.rapidssl.com/resources/cps (c)14/OU=Domain Control Validated - RapidSSL(R)/CN=*.servercontrol.com.au
    • subject:
      • serialNumber: oMSq2qRxRdxoQ4gT2A9XVGnDKoWLRoem
      • OU:
        • 0: GT70962531
        • 1: See www.rapidssl.com/resources/cps (c)14
        • 2: Domain Control Validated - RapidSSL(R)
      • CN: *.servercontrol.com.au
    • hash: cde72c00
    • issuer:
      • C: US
      • O: GeoTrust, Inc.
      • CN: RapidSSL CA
    • version: 2
    • serialNumber: 1303363
    • validFrom: 140707083925Z
    • validTo: 170907084021Z
    • validFrom_time_t: 1404722365
    • validTo_time_t: 1504773621
    • extensions:
      • authorityKeyIdentifier: keyid:6B:69:3D:6A:18:42:4A:DD:8F:02:65:39:FD:35:24:86:78:91:16:30
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • subjectAltName: DNS:*.servercontrol.com.au, DNS:servercontrol.com.au
      • crlDistributionPoints: Full Name: URI:http://rapidssl-crl.geotrust.com/crls/rapidssl.crl
      • subjectKeyIdentifier: D7:80:7A:94:0C:14:7A:5D:21:DD:EC:1E:DD:24:46:B4:EA:D5:55:CB
      • basicConstraints: CA:FALSE
      • authorityInfoAccess: OCSP - URI:http://rapidssl-ocsp.geotrust.com CA Issuers - URI:http://rapidssl-aia.geotrust.com/rapidssl.crt
      • certificatePolicies: Policy: 2.16.840.1.113733.1.7.54 CPS: http://www.geotrust.com/resources/cps

Meta - Crescentcap.com.au

Number of occurences: 2
  • Name:
    Content:
  • Name: generator
    Content: WordPress 3.7.15

Server / Hosting

  • IP: 221.121.129.2
  • Latitude: -33.49
  • Longitude: 143.21
  • Country: Australia

Rname

  • ns3.easyclouddns.net
  • ns1.easyclouddns.net
  • ns2.easyclouddns.net
  • cluster9a.us.messagelabs.com
  • cluster9.us.messagelabs.com

Target

  • root.ns1.easyclouddns.net

HTTP Header Response

HTTP/1.1 200 OK X-Powered-By: PHP/5.4.45 X-Pingback: http://www.crescentcap.com.au/xmlrpc.php Content-Type: text/html; charset=UTF-8 Link: ; rel=shortlink Content-Length: 5735 Date: Sun, 07 Aug 2016 15:02:23 GMT Accept-Ranges: bytes Server: LiteSpeed X-Cache: MISS from s_hh40 X-Cache-Lookup: MISS from s_hh40:80 Via: 1.1 s_hh40 (squid/3.5.11) Connection: keep-alive

DNS

host: crescentcap.com.au
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 221.121.129.2
host: crescentcap.com.au
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.easyclouddns.net
host: crescentcap.com.au
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.easyclouddns.net
host: crescentcap.com.au
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.easyclouddns.net
host: crescentcap.com.au
  1. class: IN
  2. ttl: 7200
  3. type: SOA
  4. mname: ns1.easyclouddns.net
  5. rname: root.ns1.easyclouddns.net
  6. serial: 2016012204
  7. refresh: 86000
  8. retry: 7200
  9. expire: 12096000
  10. minimum-ttl: 600
host: crescentcap.com.au
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 20
  5. target: cluster9a.us.messagelabs.com
host: crescentcap.com.au
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 10
  5. target: cluster9.us.messagelabs.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.rescentcap.com.au, www.cdrescentcap.com.au, www.drescentcap.com.au, www.crrescentcap.com.au, www.rrescentcap.com.au, www.ctrescentcap.com.au, www.trescentcap.com.au, www.cvrescentcap.com.au, www.vrescentcap.com.au, www.cfrescentcap.com.au, www.frescentcap.com.au, www.cgrescentcap.com.au, www.grescentcap.com.au, www.chrescentcap.com.au, www.hrescentcap.com.au, www.cnrescentcap.com.au, www.nrescentcap.com.au, www.cmrescentcap.com.au, www.mrescentcap.com.au, www.cjrescentcap.com.au, www.jrescentcap.com.au, www.cescentcap.com.au, www.criescentcap.com.au, www.ciescentcap.com.au, www.croescentcap.com.au, www.coescentcap.com.au, www.crlescentcap.com.au, www.clescentcap.com.au, www.crlescentcap.com.au, www.clescentcap.com.au, www.cr.escentcap.com.au, www.c.escentcap.com.au, www.crscentcap.com.au, www.crexscentcap.com.au, www.crxscentcap.com.au, www.cresscentcap.com.au, www.crsscentcap.com.au, www.crewscentcap.com.au, www.crwscentcap.com.au, www.crerscentcap.com.au, www.crrscentcap.com.au, www.crefscentcap.com.au, www.crfscentcap.com.au, www.crevscentcap.com.au, www.crvscentcap.com.au, www.crecscentcap.com.au, www.crcscentcap.com.au, www.creqscentcap.com.au, www.crqscentcap.com.au, www.creascentcap.com.au, www.crascentcap.com.au, www.creyscentcap.com.au, www.cryscentcap.com.au, www.crecentcap.com.au, www.cresecentcap.com.au, www.creecentcap.com.au, www.creswcentcap.com.au, www.crewcentcap.com.au, www.cresdcentcap.com.au, www.credcentcap.com.au, www.cresxcentcap.com.au, www.crexcentcap.com.au, www.cresfcentcap.com.au, www.crefcentcap.com.au, www.cresgcentcap.com.au, www.cregcentcap.com.au, www.crestcentcap.com.au, www.cretcentcap.com.au, www.cresentcap.com.au, www.crescdentcap.com.au, www.cresdentcap.com.au, www.crescrentcap.com.au, www.cresrentcap.com.au, www.cresctentcap.com.au, www.crestentcap.com.au, www.crescventcap.com.au, www.cresventcap.com.au, www.crescfentcap.com.au, www.cresfentcap.com.au, www.crescgentcap.com.au, www.cresgentcap.com.au, www.creschentcap.com.au, www.creshentcap.com.au, www.crescnentcap.com.au, www.cresnentcap.com.au, www.crescmentcap.com.au, www.cresmentcap.com.au, www.crescjentcap.com.au, www.cresjentcap.com.au, www.crescntcap.com.au, www.crescexntcap.com.au, www.crescxntcap.com.au, www.crescesntcap.com.au, www.crescsntcap.com.au, www.crescewntcap.com.au, www.crescwntcap.com.au, www.crescerntcap.com.au, www.crescrntcap.com.au, www.crescefntcap.com.au, www.crescfntcap.com.au, www.crescevntcap.com.au, www.crescvntcap.com.au, www.crescecntcap.com.au, www.cresccntcap.com.au, www.cresceqntcap.com.au, www.crescqntcap.com.au, www.cresceantcap.com.au, www.crescantcap.com.au, www.cresceyntcap.com.au, www.crescyntcap.com.au, www.crescetcap.com.au, www.crescenntcap.com.au, www.crescentcap.com.au, www.crescenhtcap.com.au, www.crescehtcap.com.au, www.crescenjtcap.com.au, www.crescejtcap.com.au, www.crescenktcap.com.au, www.crescektcap.com.au, www.crescenltcap.com.au, www.cresceltcap.com.au, www.crescen tcap.com.au, www.cresce tcap.com.au, www.crescencap.com.au, www.crescentqcap.com.au, www.crescenqcap.com.au, www.crescentacap.com.au, www.crescenacap.com.au, www.crescent cap.com.au, www.crescen cap.com.au, www.crescentwcap.com.au, www.crescenwcap.com.au, www.crescentecap.com.au, www.crescenecap.com.au, www.crescentzcap.com.au, www.crescenzcap.com.au, www.crescentxcap.com.au, www.crescenxcap.com.au, www.crescentccap.com.au, www.crescenccap.com.au, www.crescentap.com.au, www.crescentcdap.com.au, www.crescentdap.com.au, www.crescentcrap.com.au, www.crescentrap.com.au, www.crescentctap.com.au, www.crescenttap.com.au, www.crescentcvap.com.au, www.crescentvap.com.au, www.crescentcfap.com.au, www.crescentfap.com.au, www.crescentcgap.com.au, www.crescentgap.com.au, www.crescentchap.com.au, www.crescenthap.com.au, www.crescentcnap.com.au, www.crescentnap.com.au, www.crescentcmap.com.au, www.crescentmap.com.au, www.crescentcjap.com.au, www.crescentjap.com.au,

Other websites we recently analyzed

  1. mylittlelovebugz.com
    Scottsdale (United States) - 50.63.202.38
    Server software: squid/3.5.6
    Technology: Html, Html5, Iframe
  2. HOTEL BURKARTSMÃœHLE
    Das Landhotel Burkartsmühle ist die Adresse in Hofheim für einen ruhige erholsame und dabei äußerst preiswerte Übernachtung.
    Berlin (Germany) - 81.169.145.92
    Server software: Apache/2.2.31 (Unix)
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 3
  3. Ared Enerji Ared Elektrik
    Ared Enerji web sitesi.
    Turkey - 185.131.50.50
    Server software: Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4
    Technology: CSS, Html, Iframe, Javascript, Php
    Number of Javascript: 7
    Number of meta tags: 6
  4. Institut für 90°®-Lösungen - Konfliktmanagement, Lösungsfindung, Innovationstraining
    Das Institut für "90°®-Lösungen erarbeitet mit der "90°®-Methode" Lösungen für Konflikte in Firmen.
    Germany - 217.160.223.44
    Server software: Apache
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 11
  5. sinaidesert.com
    Switzerland - 141.8.225.124
    Server software: Apache
    Technology: Html
  6. Hoedown Time
    Line dancing
    United States - 75.98.17.66
    Server software: Webs.com/1.0
    Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, Google Analytics
    Number of Javascript: 6
    Number of meta tags: 5
  7. avalonspb.ru - Diese Website steht zum Verkauf! - Informationen zum Thema webarchiv.
    Diese Website steht zum Verkauf! avalonspb.ru ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf avalonspb.ru alles. Wir hoffen, dass Sie hier das Gesuchte finden!
    Germany - 82.98.86.164
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 5
  8. DrinK.TeaM
    Team de poivrons - Have a drink
    France - 91.121.119.173
    Server software: Apache
    Technology: Html, Iframe, Javascript, Php, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 5
  9. media-magnat.com
    Ukraine - 91.200.40.52
    Server software: nginx/1.2.1
    Technology: Html
  10. sriswamisamarthvishwakalyankendra.org
    Santa Ana (United States) - 107.6.45.89
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 8
    Number of meta tags: 2

Check Other Websites